PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lus10042810
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Linaceae; Linum
Family bZIP
Protein Properties Length: 78aa    MW: 8549.61 Da    PI: 4.8432
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Lus10042810genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_143.28.6e-141411050
                 HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
       bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkele 50
                 ++kNRe+A rsR+RK+a++ eLe  + +Le+e ++L ke  
  Lus10042810  1 MIKNRESAARSRERKQAYQVELESLAVKLEEEHEQLLKEKF 41
                 68**********************************99855 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF001702.2E-11139IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1704.5E-12143No hitNo description
SuperFamilySSF579592.88E-9144No hitNo description
PROSITE profilePS502178.829139IPR004827Basic-leucine zipper domain
SMARTSM003380.0074160IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 78 aa     Download sequence    Send to blast
MIKNRESAAR SRERKQAYQV ELESLAVKLE EEHEQLLKEK FLLNHAAYGE SDSCGGEAKT  60
GTNAAQSLLL GVVDDIM*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007019519.15e-17Basic-leucine zipper transcription factor family protein, putative
SwissprotP427778e-17GBF4_ARATH; G-box-binding factor 4
TrEMBLB9SE721e-17B9SE72_RICCO; Transcription factor, putative
STRINGPOPTR_0005s21500.16e-16(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF20283481
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G03970.14e-11G-box binding factor 4